Anti-CRISPR ID: | anti_CRISPR0139 |
Accession: | AGR27297.1 |
Anti-CRISPR type: | II-A |
Family: | AcrIIA1 |
Organism: | |
Taxonomy: | Bacteria;Firmicutes;Bacilli;Bacillales;Listeriaceae;Listeria |
Uniprot entry: | -- |
Uniprot entry name: | -- |
Structure: | 5Y69: 5Y6A: |
Inhibition stage: | |
Complexed with: | |
Interactor (DIP): | -- |
Interactor (STRING): | -- |
Protein sequence: | MTIKLLDEFLKKHDLTRYQLSKLTGISQNTLKDQNEKPLNKYTVSILRSLSLISGLSVSDVLFELEDIEKNSDDLAGFKHLLDKYKLSFPAQEFELYCLIKEFESANIEVLPFTFNRFENEEHVNIKKDVCKALENAITVLKEKKNELL |
Length of sequence: | 149 |
Verified: | literature |
Comments: | -- |
Pubmed: | PMID:28041849 Rauch Benjamin J,Silvis Melanie R,Hultquist Judd F et al. Inhibition of CRISPR-Cas9 with Bacteriophage Proteins.[J] .Cell, 2017, 168: 150-158.e10. |
Locus tag: | M641_01585 |
Coding region: | CP006594.1:286892..287341 |
Gene name: | -- |
Gene ID: | -- |
Gene Sequence: | -- |
IDs | Q.start | Q.end | S.start | S.end | Identity | E-value |
anti_CRISPR0134 | 1 | 149 | 1 | 149 | 100.000 | 1.01e-109 |