Anti-CRISPR ID: | anti_CRISPR3679 |
Accession: | ETD02882.1 |
Anti-CRISPR type: | I-C |
Family: | AcrIC9 |
Organism: | |
Taxonomy: | Bacteria; Proteobacteria; Alphaproteobacteria; Rhodobacterales;Rhodobacteraceae; Rhodobacter |
Uniprot entry: | -- |
Uniprot entry name: | -- |
Structure: | -- |
Inhibition stage: | |
Complexed with: | |
Interactor (DIP): | -- |
Interactor (STRING): | -- |
Protein sequence: | METKMTSFYKITAYNSQALYFWGTDADVDRYVDWLNRDREINVYAAEAIPEAEWAQYEGRDDVLSGEECGWDDFMSAEA |
Length of sequence: | 79 |
Verified: | Verfied |
Comments: | inhibit the Type I-C CRISPR/Cas system |
Pubmed: | PMID:32728052 Gussow AB, Park AE, Borges AL, et al. Machine-learning approach expands the repertoire of anti-CRISPR protein families. Nat Commun. 2020;11(1):3784. Published 2020 Jul 29. doi:10.1038/s41467-020-17652-0 |
Locus tag: | U714_04115 |
Coding region: | AYPR01000009.1:104957..105196 |
Gene name: | -- |
Gene ID: | -- |
Gene Sequence: | -- |
IDs | Q.start | Q.end | S.start | S.end | Identity | E-value |