| Anti-CRISPR ID: | anti_CRISPR0018 |
| Accession: | WP_034670926.1 |
| Anti-CRISPR type: | I-F |
| Family: | AcrIF6 |
| Organism: | |
| Taxonomy: | Bacteria;Proteobacteria;Gammaproteobacteria;Pseudomonadales;Moraxellaceae;Acinetobacter;Acinetobactercalcoaceticus/baumanniicomplex.calcoaceticus/baumannii complex |
| Uniprot entry: | -- |
| Uniprot entry name: | -- |
| Structure: | -- |
| Inhibition stage: | |
| Complexed with: | |
| Interactor (DIP): | -- |
| Interactor (STRING): | -- |
| Protein sequence: | MTLSNADSVSAVVDFINTVNDRKDHLVDHYGWGDVAATYELNDYAAAQYAWEASEDNSIESIEANLEFIKDEGAKFNTENALKIAQLFLEA |
| Length of sequence: | 91 |
| Verified: | literature |
| Comments: | -- |
| Pubmed: | PMID:27573108 Pawluk April,Staals Raymond H J,Taylor Corinda et al. Inactivation of CRISPR-Cas systems by anti-CRISPR proteins in diverse bacterial species.[J] .Nat Microbiol, 2016, 1: 16085. |
| Locus tag: | -- |
| Coding region: | -- |
| Gene name: | -- |
| Gene ID: | -- |
| Gene Sequence: | -- |
| IDs | Q.start | Q.end | S.start | S.end | Identity | E-value |
| anti_CRISPR0011 | 3 | 85 | 9 | 90 | 27.957 | 1.38e-06 |
| anti_CRISPR0013 | 3 | 89 | 6 | 79 | 22.989 | 0.14 |