| Anti-CRISPR ID: | anti_CRISPR0020 |
| Accession: | WP_022099264.1 |
| Anti-CRISPR type: | I-F |
| Family: | AcrIF6 |
| Organism: | |
| Taxonomy: | Bacteria;Proteobacteria;Gammaproteobacteria;Pseudomonadales;Moraxellaceae;Acinetobacter |
| Uniprot entry: | -- |
| Uniprot entry name: | -- |
| Structure: | -- |
| Inhibition stage: | |
| Complexed with: | |
| Interactor (DIP): | -- |
| Interactor (STRING): | -- |
| Protein sequence: | MRFTSPSRTIPSICLAIYGCGQLDRVADFINNSGEYVEDGVTFTPGMIAGQYAFEQVKLDRKGYDTRRLQKYLSFLADAGAFFSEEEALQRADDLINNFTADFGHDEDGDATFRIKAQSYRLKKYDCHALWSMINQASLTIESVKPETFCDEDSDEDISSDSLDLVLTSRLFNKQNEAFATLTQYYTVSEGMLTVEDLLDYSLLDYPNFHDESGKTYNLMENIAQRYYTECIKVVMDYFRDAHKELPDVIRSEEITSMILQPMKLPIMAN |
| Length of sequence: | 270 |
| Verified: | literature |
| Comments: | -- |
| Pubmed: | PMID:27573108 Pawluk April,Staals Raymond H J,Taylor Corinda et al. Inactivation of CRISPR-Cas systems by anti-CRISPR proteins in diverse bacterial species.[J] .Nat Microbiol, 2016, 1: 16085. |
| Locus tag: | -- |
| Coding region: | -- |
| Gene name: | -- |
| Gene ID: | -- |
| Gene Sequence: | -- |
| IDs | Q.start | Q.end | S.start | S.end | Identity | E-value |
| anti_CRISPR0011 | 16 | 89 | 8 | 83 | 35.526 | 3.20e-11 |
| anti_CRISPR0011 | 190 | 234 | 31 | 83 | 24.528 | 1.5 |
| anti_CRISPR0013 | 13 | 99 | 2 | 82 | 33.333 | 6.73e-09 |
| anti_CRISPR0008 | 23 | 55 | 14 | 41 | 33.333 | 0.11 |