Anti-CRISPR ID: | anti_CRISPR0432 |
Accession: | WP_034985946.1 |
Anti-CRISPR type: | VI-B |
Family: | AcrVIB |
Organism: | |
Taxonomy: | Bacteria;Bacteroidetes;Flavobacteriia;Flavobacteriales;Flavobacteriaceae;Bergeyella |
Uniprot entry: | -- |
Uniprot entry name: | -- |
Structure: | -- |
Inhibition stage: | |
Complexed with: | |
Interactor (DIP): | -- |
Interactor (STRING): | -- |
Protein sequence: | MIELINFSAEYVFGKAPLITAGNLSDGLLFFAIALFIGCLIHIITFWLIKRKWYKKLACTPMDKMKNDEYITEILPDLKEIYRTNKGISVTENISNGSVFDTAYYYLEAQGKISQAKNFQSIYFLFRNIVTLSLFVLPVSVIFLLASFFMNDCSLSEKIITIIIGTFVLGGLSSVIAQWFRVKMTDRIFGLYYAELTHNKK |
Length of sequence: | 201 |
Verified: | Verified |
Comments: | Csx27, was identified as an inhibitor for both B. zoohelcum Cas13b (type VI-B1) and P. buccae Cas13b (type VI-B2) systems |
Pubmed: | PMID:28065598 Smargon Aaron A,Cox David B T,Pyzocha Neena K et al. Cas13b Is a Type VI-B CRISPR-Associated RNA-Guided RNase Differentially Regulated by Accessory Proteins Csx27 and Csx28.[J] .Mol. Cell, 2017, 65: 618-630.e7. |
Locus tag: | -- |
Coding region: | -- |
Gene name: | -- |
Gene ID: | -- |
Gene Sequence: | -- |