Anti-CRISPR ID: | anti_CRISPR3628 |
Accession: | WP_050337628.1 |
Anti-CRISPR type: | II-A |
Family: | AcrIIA13 |
Organism: | |
Taxonomy: | Bacteria;Terrabacteria group;Firmicutes;Bacilli;Bacillales;Staphylococcaceae;Staphylococcus |
Uniprot entry: | -- |
Uniprot entry name: | -- |
Structure: | -- |
Inhibition stage: | |
Complexed with: | |
Interactor (DIP): | -- |
Interactor (STRING): | -- |
Protein sequence: | MEVMNKSIEIKDQNNIVLIDSLGQFFTDIENDNNGRYNIDYVLLNEVEHDNGNTYYEVGMYRTEEVPFSDKVTQDNVELLEDKWLQIDQQGESYVESIFFENEEDAREYIKLVLKGHETFEETAKAIGVIK |
Length of sequence: | 131 |
Verified: | Verified |
Comments: | robust inhibition of SauCas9-induced genome editing |
Pubmed: | PMID:32156733 Watters KE, Shivram H, Fellmann C, Lew RJ, McMahon B, Doudna JA. Potent CRISPR-Cas9 inhibitors from Staphylococcus genomes. Proc Natl Acad Sci U S A. 2020;117(12):6531‐6539. |
Locus tag: | -- |
Coding region: | -- |
Gene name: | -- |
Gene ID: | -- |
Gene Sequence: | -- |